General Information

  • ID:  hor004214
  • Uniprot ID:  P01019
  • Protein name:  Angiotensin-2
  • Gene name:  AGT
  • Organism:  Homo sapiens (Human)
  • Family:  Serpin family
  • Source:  Human
  • Expression:  Expressed by the liver and secreted in plasma.
  • Disease:  Diseases associated with AGT include Renal Tubular Dysgenesis and Hypertension, Essential.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008083 growth factor activity; GO:0031702 type 1 angiotensin receptor binding; GO:0031703 type 2 angiotensin receptor binding
  • GO BP:  GO:0001558 regulation of cell growth; GO:0001819 positive regulation of cytokine production; GO:0001822 kidney development; GO:0001974 blood vessel remodeling; GO:0002016 regulation of blood volume by renin-angiotensin; GO:0002018 renin-angiotensin regulation of aldosterone production; GO:0002019 regulation of renal output by angiotensin; GO:0002034 maintenance of blood vessel diameter homeostasis by renin-angiotensin; GO:0003014 renal system process; GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007199 G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007263 nitric oxide mediated signal transduction; GO:0007267 cell-cell signaling; GO:0008217 regulation of blood pressure; GO:0010536 positive regulation of activation of Janus kinase activity; GO:0010595 positive regulation of endothelial cell migration; GO:0010613 positive regulation of cardiac muscle hypertrophy; GO:0010718 positive regulation of epithelial to mesenchymal transition; GO:0010744 positive regulation of macrophage derived foam cell differentiation; GO:0014873 response to muscle activity involved in regulation of muscle adaptation; GO:0019229 regulation of vasoconstriction; GO:0033864 positive regulation of NAD(P)H oxidase activity; GO:0034374 low-density lipoprotein particle remodeling; GO:0035813 regulation of renal sodium excretion; GO:0038166 angiotensin-activated signaling pathway; GO:0042127 regulation of cell population proliferation; GO:0042310 vasoconstriction; GO:0042981 regulation of apoptotic process; GO:0043407 negative regulation of MAP kinase activity; GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway; GO:0045893 positive regulation of D
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol; GO:0062023 collagen-containing extracellular matrix; GO:0070062 extracellular exosome; GO:0072562 blood microparticle

Sequence Information

  • Sequence:  DRVYIHPF
  • Length:  8
  • Propeptide:  MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA
  • Signal peptide:  MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAG
  • Modification:  T1 Beta-decarboxylated aspartate
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AGTR2, AGTR1
  • Target Unid:  P50052, P30556
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01019-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004214_AF2.pdbhor004214_ESM.pdb

Physical Information

Mass: 117123 Formula: C50H71N13O12
Absent amino acids: ACEGKLMNQSTW Common amino acids: DFHIPRVY
pI: 7.54 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -32.5 Boman Index: -1650
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 85
Instability Index: 2580 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  NA
  • Title:  NA